Skip to Content
Merck
All Photos(1)

Documents

Safety Information

AV54329

Sigma-Aldrich

Anti-IL4 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-BSF1, Anti-IL-4, Anti-Interleukin 4, Anti-MGC79402

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

15 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_758858

UniProt accession no.

P05112

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... IL4(3565)

Related Categories

Immunogen

Synthetic peptide directed towards the middle region of human IL4

Application

Anti-IL4 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

Interleukin-4 (IL-4) is a T cell derived chemokine that stimulates the Th2 mediated immune response and proliferation of B cells. The effects of IL-4 are mediated by two types of receptors, type I receptor consisting of IL-4Rα and common γ chain and type II receptor composed of IL-4Rα and IL-13Rα1. The signalling stimulated by IL-4 leads to activation of JAK/STAT6 and IRS-mediated PI3K/Akt pathway. Through these pathways, IL-4 is responsible for endocytic activity of macrophages, chemotaxis of leukocytes in response to inflammation, angiogenesis and regulation of nitric oxide metabolism in macrophages. Anti-tumor effects of IL-4 have been reported in cancers of breast, liver and renal cells.

Sequence

Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AV54329-50UG:
AV54329-100UL:

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Alberto Mantovani et al.
Trends in immunology, 25(12), 677-686 (2004-11-09)
Plasticity and functional polarization are hallmarks of the mononuclear phagocyte system. Here we review emerging key properties of different forms of macrophage activation and polarization (M1, M2a, M2b, M2c), which represent extremes of a continuum. In particular, recent evidence suggests
E M Coccia et al.
International immunology, 12(7), 977-985 (2000-07-06)
NO is a labile radical involved in several immunological, antimicrobial and inflammatory processes. In macrophages, NO formation is catalyzed by the cytokine-inducible enzyme inducible NO synthase (iNOS). The importance of IFN regulatory factor (IRF)-1 and of the signal transducers and
C K Oh et al.
European respiratory review : an official journal of the European Respiratory Society, 19(115), 46-54 (2010-10-20)
Asthma is a complex, persistent, inflammatory disease characterised by airway hyperresponsiveness in association with airway inflammation. Studies suggest that regular use of high-dose inhaled corticosteroids and long-acting bronchodilators or omalizumab (a humanised monoclonal antibody that binds to immunoglobulin E and
Jane Gilmour et al.
Immunology, 124(4), 437-444 (2008-05-16)
The mechanism of differentiation of naïve T cells to a variety of effector lineages, but particularly to T helper type 1 (Th1) and Th2 cells, has been the subject of intense scrutiny over the past two decades. Studies have revealed
Hao-Wei Wang et al.
Cell cycle (Georgetown, Tex.), 9(24), 4824-4835 (2010-12-15)
Although macrophages were originally recognized as major immune effector cells, it is now appreciated that they also play many important roles in the maintenance of tissue homeostasis, and are involved in a variety of pathological conditions including cancer. Several studies
View All Related Papers

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service