Skip to Content
Merck
All Photos(4)

Key Documents

Safety Information

AV40922

Sigma-Aldrich

Anti-MATR3 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Matrin 3

Sign Into View Organizational & Contract Pricing

Select a Size


Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

93 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

Related Categories

General description

Matrin 3 (MATR3) is a zinc finger inner nuclear matrix protein with two RNA recognition motifs (RRM). MATR3, which is highly regulated, complexes with and stabilizes specific gene transcripts that are currently being identified. Rev appears to be a MATR3 cofactor.

Specificity

Anti-MATR3 (AB1) polyclonal antibody reacts with chicken, human, mouse, rat, and bovine matrin 3 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human MATR3

Application

Anti-MATR3 (AB1) polyclonal antibody is used to tag matrin 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of matrin 3 as a selective nuclear gene transcript stabilizer.

Biochem/physiol Actions

MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.The protein encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene.

Sequence

Synthetic peptide located within the following region: MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AV40922-100UG:
AV40922-100UL:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Daphna Nachmani et al.
Nature communications, 5, 4186-4186 (2014-06-14)
The recognition of stress-induced ligands by the activating receptor NKG2D expressed on cytotoxic lymphocytes is crucial for the prevention and containment of various diseases and is also one of the best-studied examples of how danger is sensed by the immune

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service