Skip to Content
Merck
All Photos(3)

Key Documents

Safety Information

AV100841

Sigma-Aldrich

Anti-IRF8 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Interferon regulatory factor 8

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

48 kDa

species reactivity

human, dog, rat, horse, rabbit, guinea pig, mouse, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IRF8(3394)

General description

Interferon regulatory factors are transcription factors that regulate the expression of interferon system. The activity of IRF-8 has been implicated in vascular diseases.

Immunogen

Synthetic peptide directed towards the N terminal region of human IRF8

Application

Anti-IRF8 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5-2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Biochem/physiol Actions

IRF-8 regulates the activity of myocardin and modulates the phenotype of smooth muscle cells. It regulates the development and function of T cells, B cells and macrophages. IRF-8 induces the production of type 1 interferons in dendritic cells.

Sequence

Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AV100841-100UL:
AV100841-50UG:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Runqing Lu
Trends in immunology, 29(10), 487-492 (2008-09-09)
Interferon regulatory factor 4 (IRF4) and 8 are members of the interferon regulatory factor family of transcription factors and have been shown to be essential for the development and function of T cells, macrophages and dendritic cells. A series of
Prafullakumar Tailor et al.
Immunity, 27(2), 228-239 (2007-08-19)
Dendritic cells (DCs) produce type I interferons (IFNs) in greater amounts than other cells, but the mechanisms remain elusive. Here we studied the role of a transcription factor, IRF8, in DC induction of type I IFNs. Upon newcastle disease virus
Shu-Min Zhang et al.
Molecular and cellular biology, 34(3), 400-414 (2013-11-20)
Interferon regulatory factor 8 (IRF8), a member of the IRF transcription factor family, was recently implicated in vascular diseases. In the present study, using the mouse left carotid artery wire injury model, we unexpectedly observed that the expression of IRF8

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service