Skip to Content
Merck
All Photos(1)

Key Documents

Safety Information

MAB2290

Sigma-Aldrich

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3

clone 29A3, Chemicon®, from mouse

Synonym(s):

CD49c

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
eCl@ss:
32160702
NACRES:
NA.41

biological source

mouse

Quality Level

antibody form

purified antibody

antibody product type

primary antibodies

clone

29A3, monoclonal

species reactivity

human

manufacturer/tradename

Chemicon®

technique(s)

immunocytochemistry: suitable
immunohistochemistry: suitable
western blot: suitable

isotype

IgG1

NCBI accession no.

UniProt accession no.

shipped in

wet ice

target post-translational modification

unmodified

Gene Information

human ... ITGA3(3675)

General description

MAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.

Specificity

Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman′s capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.

SPECIES REACTIVITIES:

Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.

Immunogen

Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY

Application

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.
Western Blot

Immunocytochemistry

Immunohistochemistry (Frozen Sections)

Optimal working dilutions must be determined by the end user.

Physical form

Format: Purified
Purified. Liquid in PBS containing 0.01% sodium azide.

Other Notes

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Legal Information

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

MAB2290:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Canine malignant melanoma alpha-3 integrin binding peptides.
Aina, OH; Maeda, Y; Harrison, M; Zwingenberger, AL; Walker, NJ; Lam, KS; Kent, MS
Veterinary Immunology and Immunopathology null
Frédéric Dallaire et al.
Journal of virology, 83(11), 5329-5338 (2009-03-20)
The human adenovirus E4orf6 and E1B55K proteins promote viral replication by targeting several cellular proteins for degradation. The E4orf6 product has been shown by our group and others to form an E3 ubiquitin ligase complex that contains elongins B and
Frédéric Dallaire et al.
Journal of virology, 83(23), 12172-12184 (2009-09-18)
It has been known for some time that the human adenovirus serotype 5 (Ad5) E4orf6 and E1B55K proteins work in concert to degrade p53 and to regulate selective export of late viral mRNAs during productive infection. Both of these functions
Jake D Howden et al.
BMC biology, 19(1), 130-130 (2021-06-24)
Keratinocytes form the main protective barrier in the skin to separate the underlying tissue from the external environment. In order to maintain this barrier, keratinocytes form robust junctions between neighbouring cells as well as with the underlying extracellular matrix. Cell-cell
Role of integrins in the assembly and function of hensin in intercalated cells.
Vijayakumar, S; Erdjument-Bromage, H; Tempst, P; Al-Awqati, Q
Journal of the American Society of Nephrology null

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service