WH0010875M1

Monoclonal Anti-FGL2 antibody produced in mouse

clone 6D9, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-T49, Anti-fibrinogen-like 2, Anti-pT49
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 6D9, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human, mouse, rat
• tecniche: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_006682
• N° accesso UniProt: Q14314
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FGL2(10875)

Descrizione

Descrizione generale

Fibrinogen-like protein 2 (FGL2) belongs to the fibrinogen-like protein family. The FGL2 gene is located on the human chromosome at 7q11.23.

Immunogeno

FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG

Applicazioni

Monoclonal Anti-FGL2 antibody produced in mouse has been used in immunohistochemistry.

Azioni biochim/fisiol

Fibrinogen-like protein 2 (FGL2) exhibits prothrombinase activity. It also shows immune regulatory activity during allograft rejection, abortion, and viral infections. This protein acts as an immune coagulant that produces thrombin directly. FGL2 through the clotting-dependent pathway may play a role in tumor angiogenesis and metastasis. It is involved in the pathogenesis of T helper type 1 (Th1) cytokine-induced fetal loss syndrome and viral-induced fulminant hepatitis. FGL2 gene is involved in modulating regulatory T cells (Treg) function. This protein regulates innate and adaptive immunity. FGL2 may serve as a therapeutic agent for glioblastoma (GBM) by promoting GBM progression.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)