WH0010397M3

Monoclonal Anti-NDRG1 antibody produced in mouse

clone 2D7, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-CAP43, Anti-CMT4D, Anti-DRG1, Anti-GC4, Anti-HMSNL, Anti-N-myc downstream regulated gene 1, Anti-NDR1, Anti-NMSL, Anti-PROXY1, Anti-RIT42, Anti-RTP, Anti-TARG1, Anti-TDD5
• Numero MDL: MFCD03454849
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2D7, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: BC003175
• N° accesso UniProt: Q92597
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... NDRG1(10397)

Descrizione

Descrizione generale

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. It is necessary for p53-mediated caspase activation and apoptosis. Mutation in this gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom. Multiple alternatively spliced variants, encoding the same protein, have been identified. (provided by RefSeq)

Immunogeno

NDRG1 (AAH03175, 1 a.a. ~ 394 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC

Applicazioni

Monoclonal Anti-NDRG1 antibody produced in mouse has been used in immunohistochemistry and Western blotting.

Azioni biochim/fisiol

NDRG1 (N-myc downstream regulated 1) is a Rab4a (Ras-related protein Rab-4A) effector protein associated with cell proliferation, differentiation, and invasion. It localizes at the perinuclear recycling/sorting vesicles of trans Golgi network. NDRG1 is essentially required for the p53-dependent apoptosis. At the site of DNA damage, its elevated expression identifies the target genes required for mediating apoptosis. It also plays a major role in the recycling and stabilization of adhesion molecule E-cadherin. In endosome recycling, NDRG1 interacts with the membrane bound Rab4aGTPase. Reports show that NDRG1 acts as a biomarker in the development of colorectal cancer (CRC).

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)