WH0004478M13

Monoclonal Anti-MSN antibody produced in mouse

clone 4B8, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-moesin
• Numero MDL: MFCD01633643
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 4B8, monoclonal
• Stato: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_002444
• N° accesso UniProt: P26038
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MSN(4478)

Descrizione

Descrizione generale

Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement. (provided by RefSeq)

Immunogeno

MSN (NP_002435, 422 a.a. ~ 531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELAN

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)