WH0003559M4
Monoclonal Anti-IL2RA antibody produced in mouse
clone 1D6, purified immunoglobulin, buffered aqueous solution
Sinonimo/i:
Anti-CD25, Anti-IL2R, Anti-TCGFR, Anti-interleukin 2 receptor, alpha
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Prodotti consigliati
Origine biologica
mouse
Coniugato
unconjugated
Forma dell’anticorpo
purified immunoglobulin
Tipo di anticorpo
primary antibodies
Clone
1D6, monoclonal
Forma fisica
buffered aqueous solution
Reattività contro le specie
human
tecniche
indirect ELISA: suitable
western blot: 1-5 μg/mL
Isotipo
IgG2aκ
N° accesso Genebanck
N° accesso UniProt
Condizioni di spedizione
dry ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... IL2RA(3559)
Descrizione generale
Interleukin 2 receptor alpha (IL2RA) is a part of the IL-2 receptor. It is expressed on regulatory T cells. IL2RA gene is mapped to human chromosome 10p15.1.
Immunogeno
IL2RA (NP_000408, 22 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL*
Sequence
ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL*
Azioni biochim/fisiol
Interleukin 2 receptor alpha (IL2RA) combines with a tri-molecular complex to exhibit a high-affinity receptor for IL-2. Activated immune cells release IL2RA and produce soluble (sIL2RA). Higher circulating levels of sIL2RA leads to multiple sclerosis (MS) disease activities. IL2RA initiates T cell proliferation in an autocrine and paracrine manner. Elevated levels of IL-2R is detected in coronavirus disease 2019 (COVID-19)infected patients.
Stato fisico
Solution in phosphate buffered saline, pH 7.4
Note legali
GenBank is a registered trademark of United States Department of Health and Human Services
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Raccomandato
N° Catalogo
Descrizione
Determinazione del prezzo
Codice della classe di stoccaggio
10 - Combustible liquids
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Dispositivi di protezione individuale
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Max Mimpen et al.
Journal of neuroimmunology, 353, 577499-577499 (2021-02-03)
NK/T-cell ratios predict disease activity in relapsing remitting multiple sclerosis (RRMS). We investigated in 50 RRMS patients whether interleukin-2 receptor alpha-chain (IL-2Rα) expression and shedding associates with NK/T-cell balance, as suggested by daclizumab-trials in RRMS. A subsample (N = 31) was genotyped
Víctor J Costela-Ruiz et al.
Cytokine & growth factor reviews, 54, 62-75 (2020-06-10)
COVID-19 disease, caused by infection with SARS-CoV-2, is related to a series of physiopathological mechanisms that mobilize a wide variety of biomolecules, mainly immunological in nature. In the most severe cases, the prognosis can be markedly worsened by the hyperproduction
Daniela B Engler et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(32), 11810-11815 (2014-07-31)
The prevalence of allergic asthma and other atopic diseases has reached epidemic proportions in large parts of the developed world. The gradual loss of the human indigenous microbiota has been held responsible for this trend. The bacterial pathogen Helicobacter pylori
Hong Guo et al.
Journal of leukocyte biology, 96(3), 419-426 (2014-05-29)
C/EBPα is expressed preferentially in myeloid compared with lymphoid or erythroid cells and directs myeloid lineage specification. C/EBPα is also expressed at lower levels in HSCs and in several nonhematopoietic tissues. The Cebpa gene has a conserved, 450-bp segment at
Fanhang Meng et al.
Inflammation, 37(5), 1799-1805 (2014-05-03)
Myeloid-derived suppressor cells (MDSCs) are negative regulators of the immune response and are in part responsible for the inhibition of the T cell-mediated immune response. A recent paper indicated that MDSCs were involved in prolonged allograft survival in animal models
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.