WH0002303M2

Monoclonal Anti-FOXC2 antibody produced in mouse

clone 2H3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-FKHL14, Anti-MFH1, Anti-forkhead box C2 (MFH-1, mesenchyme forkhead 1)
• Numero MDL: MFCD06411812
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2H3, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: mouse, human, rat
• tecniche: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bλ
• N° accesso Genebanck: NM_005251
• N° accesso UniProt: Q99958
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FOXC2(2303)

Descrizione

Descrizione generale

Forkhead Box Protein C2 (FOXC2) is a transcription factor. It belongs to the forkhead/winged-helix family of transcription factors. This gene is located on human chromosome 16q24.

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. (provided by RefSeq)

Immunogeno

FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY

Applicazioni

Monoclonal Anti-FOXC2 antibody has been used in immunohistochemistry.

Azioni biochim/fisiol

Forkhead Box Protein C2 (FOXC2) controls YAP (yes-associated protein) signaling and stimulates the progression of nasopharyngeal carcinoma by promoting glycolysis. It plays a major role in inducing invasion and metastasis. Mutations in FOXC2 result in hereditary Lymphedema-Distichiasis syndrome.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)