WH0001719M1

Monoclonal Anti-DHFR antibody produced in mouse

clone 2B10, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-dihydrofolate reductase
• Numero MDL: MFCD01633296
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2B10, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: rat, mouse, human
• tecniche: indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: BC003584
• N° accesso UniProt: P00374
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... DHFR(1719)

Descrizione

Descrizione generale

Dihydrofolate reductase (DHFR) is encoded by the gene mapped to human chromosome 5q14. The encoded protein belongs to reductase family of enzymes. It is ubiquitously expressed in all organisms. DHFR is characterized with an α/β fold with a central 8-stranded sheet, flanked by four α helices.

Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. (provided by RefSeq)

Immunogeno

DHFR (AAH03584, 88 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND

Azioni biochim/fisiol

Dihydrofolate reductase (DHFR) is a folate-metabolizing enzyme that catalyzes nicotinamide adenine dinucleotide phosphate (NADPH)-dependent reduction of dihydrofolate (DHF) to tetrahydrofolate (THF), as well as folic acid to DHF. The encoded protein is implicated in regulation of intracellular folate homeostasis and it acts as a key target for cytostatic drugs. Genetic variations in the gene is associated with the development of various neurologic diseases.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)