WH0001434M1

Monoclonal Anti-CSE1L antibody produced in mouse

clone 2B7, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-CAS, Anti-CSE1, Anti-CSE1 chromosome segregation 1-like (yeast), Anti-XPO2
• Numero MDL: MFCD01633086
• Codice UNSPSC: 12352203
• NACRES: NA.41
• Coniugato: unconjugated
• application: ELISA; IF; WB
• Clone: 2B7, monoclonal
• Reattività contro le specie: human
• tecniche: ELISA: suitable; immunofluorescence: suitable; western blot: 1-5 μg/mL

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2B7, monoclonal
• Stato: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: ELISA: suitable; immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: NM_001316
• N° accesso UniProt: P55060
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CSE1L(1434)

Descrizione

Descrizione generale

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. (provided by RefSeq)

Immunogeno

CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)