Passa al contenuto
Merck
Tutte le immagini(5)

Documenti fondamentali

WH0001104M1

Sigma-Aldrich

Monoclonal Anti-RCC1 antibody produced in mouse

clone 2F1, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-CHC1, Anti-RCC1I, Anti-regulator of chromosome condensation 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Numero MDL:
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2F1, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... RCC1(1104)

Descrizione generale

Regulator of chromosome condensation 1 (RCC1) is a nuclear guanine nucleotide exchange factor for the small GTPase Ran enzyme. The gene is located on human chromosome 1p35.3. It is a 45 kDa protein.

Immunogeno

RCC1 (AAH07300, 312 a.a. ~ 421 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS

Azioni biochim/fisiol

Regulator of chromosome condensation 1 (RCC1) interacts with chromatin and contributes to the formation of RanGTP gradients, which is required for nucleo-cytoplasmic transport, mitotic spindle formation and nuclear envelope reassembly following mitosis. It is an important cell cycle regulator. The protein functions as a tumor suppressor in gastric carcinoma.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Nuclear import of the Ran exchange factor, RCC1, is mediated by at least two distinct mechanisms
Nemergut ME, et al.
The Journal of Cell Biology, 149(4), 835-850 (2000)
Integrated analysis profiles of long non-coding RNAs reveal potential biomarkers of drug resistance in lung cancer
Xue WL, et al.
Oncotarget, 8(38), 62868-62868 (2017)
Methylation-silencing RCC1 expression is associated with tumorigenesis and depth of invasion in gastric cancer
Lin YL, et al.
International Journal of Clinical and Experimental Pathology, 8(11), 14257-14257 (2015)
Epstein-Barr virus nuclear antigen 1 interacts with regulator of chromosome condensation 1 dynamically throughout the cell cycle
Deschamps T, et al.
The Journal of General Virology, 98(2), 251-265 (2017)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.