WH0001021M1

Monoclonal Anti-CDK6 antibody produced in mouse

clone 8H4, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-MGC59692, Anti-PLSTIRE, Anti-cyclin-dependent kinase 6
• Numero MDL: MFCD01321821
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 8H4, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: mouse, human, rat
• tecniche: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: NM_001259
• N° accesso UniProt: Q00534
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CDK6(1021)

Descrizione

Descrizione generale

Cyclin dependent kinase 6 (CDK6) is encoded by the gene mapped to human chromosome 7q21.2. The encoded protein is ubiquitously expressed and is a member of CDK family.

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. (provided by RefSeq)

Immunogeno

CDK6 (NP_001250, 3 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFE

Azioni biochim/fisiol

Cyclin dependent kinase 6 (CDK6) plays a vital role in regulation of cell‐cycle and thus, it is considered as a potent therapeutic target for cancers.The protein expressed in human hematopoietic stem cells (HSC), modulates quiescence exit. Elevated expression of the gene has been observed in various types of cancers such as leukemia and lymphomas.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)