WH0001000M1
Monoclonal Anti-CDH2 antibody produced in mouse
clone 5C8, purified immunoglobulin, buffered aqueous solution
Sinonimo/i:
Anti-CDHN, Anti-NCAD, Anti-cadherin 2, type 1, N-cadherin (neuronal)
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Origine biologica
mouse
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
purified immunoglobulin
Tipo di anticorpo
primary antibodies
Clone
5C8, monoclonal
Forma fisica
buffered aqueous solution
Reattività contro le specie
human
tecniche
indirect ELISA: suitable
western blot: 1-5 μg/mL
Isotipo
IgG2aκ
N° accesso Genebanck
N° accesso UniProt
Condizioni di spedizione
dry ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... CDH2(1000)
Descrizione generale
This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. The protein functions during gastrulation and is required for establishment of left-right asymmetry. At certain central nervous system synapses, presynaptic to postsynaptic adhesion is mediated at least in part by this gene product. (provided by RefSeq)
Immunogeno
CDH2 (NP_001783, 807 a.a. ~ 906 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Sequence
RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Stato fisico
Solution in phosphate buffered saline, pH 7.4
Note legali
GenBank is a registered trademark of United States Department of Health and Human Services
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Raccomandato
N° Catalogo
Descrizione
Determinazione del prezzo
Codice della classe di stoccaggio
10 - Combustible liquids
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Dispositivi di protezione individuale
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Sridhar Muthusami et al.
Cancer letters, 351(2), 252-259 (2014-06-28)
The role of Fused Toes Homolog (FTS) in epidermal growth factor (EGF) induced epithelial-mesenchymal transition (EMT) in cervical cancer cells was studied. EGF treatment induced the change of EMT markers and increased cell migration. EGF treatment also increased phosphorylated EGFR
Julie L Chan et al.
Experimental neurology, 261, 757-771 (2014-08-26)
Traumatic brain injury (TBI) produces axotomy, deafferentation and reactive synaptogenesis. Inflammation influences synaptic repair, and the novel brain cytokine osteopontin (OPN) has potential to support axon regeneration through exposure of its integrin receptor binding sites. This study explored whether OPN
Naris Nilubol et al.
The Journal of clinical endocrinology and metabolism, 99(7), E1173-E1182 (2014-03-25)
Identification of molecular factors that promote thyroid cancer progression have important clinical implications for therapy and prognostication in patients with papillary thyroid cancer (PTC). The aim of this study was to validate and determine the function of dysregulated genes that
Shih-Hsiu J Wang et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(38), 12745-12761 (2014-09-19)
Most excitatory synapses in the mammalian brain are formed on dendritic spines, and spine density has a profound impact on synaptic transmission, integration, and plasticity. Membrane-associated guanylate kinase (MAGUK) proteins are intracellular scaffolding proteins with well established roles in synapse
Dandan Yuan et al.
International journal of oncology, 45(6), 2430-2438 (2014-09-10)
Both circulating tumor cells (CTCs) and epithelial-mesenchymal transition (EMT) play an important role in invasion, migration and chemoresistant in tumor development. This study aimed to detect whether EMT occurred in human gastric CTCs and to explore the mechanism of EMT
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.