SAB5702616

Anti-OPRD1 Antibody, clone 1R4W8, Rabbit Monoclonal

• Sinonimo/i: OPRD
• Codice UNSPSC: 12352203
• NACRES: NA.46
• Clone: 1R4W8, monoclonal
• application: WB
• Reattività contro le specie: rat, human, rat
• tecniche: western blot: 1:500 - 1:2000

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 1R4W8, monoclonal
• Stato: liquid
• PM: 45 kDa
• Reattività contro le specie: rat, human, rat
• Concentrazione: 1.1 mg/mL
• tecniche: western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATS
• N° accesso UniProt: P41143
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... OPRD1(4985)

Descrizione

Descrizione generale

G-protein coupled receptor that functions as receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine.

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OPRD1 (P41143).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1