SAB5702371

Anti-HTRA2 Antibody, clone 4H8C4, Rabbit Monoclonal

• Sinonimo/i: MGCA8, OMI, PARK13, PRSS25
• Codice UNSPSC: 12352203

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 4H8C4, monoclonal
• Forma fisica: liquid
• PM: 36 kDa
• Reattività contro le specie: rat, human, rat
• Concentrazione: 0.48 mg/mL
• tecniche: western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: GTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVV
• N° accesso UniProt: O43464
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... HTRA2(27429)

Descrizione

Descrizione generale

This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HTRA2 (O43464).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1