SAB5702307

Anti-MSR1 Antibody, clone 10O8B0, Rabbit Monoclonal

• Sinonimo/i: CD204, SCARA1, SR-A, SR-AI, SR-AII, SR-AIII, SRA, phSR1, phSR2
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 10O8B0, monoclonal
• Forma fisica: liquid
• PM: 70 kDa
• Reattività contro le specie: rat, rat, human
• Concentrazione: 1.40 mg/mL
• tecniche: immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: MEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGIVAAQLLKWETKNCSVSSTNANDITQSLTGK
• N° accesso UniProt: P21757
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MSR1(4481)

Descrizione

Descrizione generale

This gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimer's disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages. [provided by RefSeq, Jul 2008]

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSR1 (P21757).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB, IHC

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1