SAB5702277

[KO Validated]Anti-SIRT3 Antibody, clone 7O4G7, Rabbit Monoclonal

• Sinonimo/i: SIRT3,SIR2L3,sirtuin 3
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 7O4G7, monoclonal
• Forma fisica: liquid
• PM: 28 kDa
• Reattività contro le specie: rat, human, rat
• Concentrazione: 1 mg/mL
• tecniche: immunohistochemistry: 1:50 - 1:200; immunoprecipitation (IP): 1:500 - 1:1000; western blot: 1:500 - 1:1000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
• N° accesso UniProt: Q9NTG7
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SIRT3(23410)

Descrizione

Descrizione generale

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene.

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB, IHC, IP

Informazioni sulla sicurezza

• Pittogrammi: GHS07,GHS09
• Avvertenze: Warning
• Indicazioni di pericolo: H317,H411
• Consigli di prudenza: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classi di pericolo: Aquatic Chronic 2 - Skin Sens. 1
• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3