SAB5702269

Anti-CD68 Antibody, clone 5S2F7, Rabbit Monoclonal

• Sinonimo/i: CD68,GP110,LAMP4,SCARD1
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 5S2F7, monoclonal
• Stato: liquid
• PM: 80-130 kDa
• Reattività contro le specie: human, rat, rat
• Concentrazione: 1 mg/mL
• tecniche: flow cytometry: 1:50 - 1:200; western blot: 1:500 - 1:1000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: TSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK
• N° accesso UniProt: P34810
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CD68(968)

Descrizione

Descrizione generale

This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB, FC

Informazioni sulla sicurezza

• Pittogrammi: GHS07,GHS09
• Avvertenze: Warning
• Indicazioni di pericolo: H317,H411
• Consigli di prudenza: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classi di pericolo: Aquatic Chronic 2 - Skin Sens. 1
• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3