SAB5702254

Anti-SST Antibody

rabbit monoclonal, 7Q4T0

• Sinonimo/i: SST,SMST
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• product name: Anti-Somatostatin (SST) Antibody, clone 7Q4T0, Rabbit Monoclonal,
• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 7Q4T0, monoclonal
• Forma fisica: liquid
• Reattività contro le specie: mouse, rat
• Concentrazione: 1 mg/mL
• tecniche: immunohistochemistry: 1:50 - 1:200
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
• N° accesso UniProt: P61278
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SST(6750)

Descrizione

Descrizione generale

The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.

Immunogeno

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human Somatostatin (SST) (NP_001039.1).

Applicazioni

IHC

Informazioni sulla sicurezza

• Pittogrammi: GHS07,GHS09
• Avvertenze: Warning
• Indicazioni di pericolo: H317,H411
• Consigli di prudenza: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classi di pericolo: Aquatic Chronic 2 - Skin Sens. 1
• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3