SAB5702114

Anti-Synapsin II Antibody, clone 7J6L0, Rabbit Monoclonal

• Sinonimo/i: SYNII
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 7J6L0, monoclonal
• Forma fisica: liquid
• PM: 60 kDa
• Reattività contro le specie: human, rat, rat
• Concentrazione: 0.61 mg/mL
• tecniche: immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: HLIIGMQYAGLPSINSLESIYNFCDKPWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQT
• N° accesso UniProt: Q92777
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SYN2(6854)

Descrizione

Descrizione generale

This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family encodes a neuron-specific phosphoprotein that selectively binds to small synaptic vesicles in the presynaptic nerve terminal. Polymorphisms in this gene are associated with abnormal presynaptic function and related neuronal disorders, including autism, epilepsy, bipolar disorder and schizophrenia. Alternative splicing of this gene results in multiple transcript variants. The tissue inhibitor of metalloproteinase 4 gene is located within an intron of this gene and is transcribed in the opposite direction. [provided by RefSeq, Feb 2014]

Immunogeno

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human Synapsin II (Q92777).

Applicazioni

WB, IF/ICC

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1