SAB5201356

Monoclonal Anti-Ataxin 1 antibody produced in mouse

clone S76-8, purified immunoglobulin

• Sinonimo/i: Anti-ATX1, Anti-D6S504E, Anti-Spinocerebellar ataxia type 1 protein
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: S76-8, monoclonal
• Stato: buffered aqueous solution
• PM: antigen predicted mol wt 85 kDa
• Reattività contro le specie: human, mouse, rat
• Concentrazione: 1 mg/mL
• tecniche: immunohistochemistry: suitable; immunoprecipitation (IP): suitable; western blot: suitable
• Isotipo: IgG2b
• N° accesso NCBI: NP_001186233.1
• N° accesso UniProt: P54253
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: mouse ... Atxn1(20238)

Descrizione

Immunogeno

Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Caratteristiche e vantaggi

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Stato fisico

PBS pH 7.4, 50% glycerol, 0.1% sodium azide

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable