SAB2109108

Anti-MAPK1 (C-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: ERK, ERK2, ERT1, MAPK2, P42MAPK
• Codice UNSPSC: 12352203
• NACRES: NA.43

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 41 kDa
• Reattività contro le specie: rat
• Reattività contro le specie (prevista in base all’omologia): goat, rabbit, mouse, guinea pig, horse, human, zebrafish, canine, bovine
• Concentrazione: 0.5 mg/mL
• tecniche: immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL; western blot: 1 μg/mL
• N° accesso NCBI: NM_138957
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MAPK1(57396)

Descrizione

Descrizione generale

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.

Immunogeno

Synthetic peptide directed towards the C terminal region of human MAPK1

Sequenza

Synthetic peptide located within the following region: PYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Stato fisico

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable