SAB2108992

Anti-PREX2 (N-terminal) antibody produced in rabbit FITC conjugated

affinity isolated antibody

• Sinonimo/i: Cktsf1b1, Drm, ld
• Codice UNSPSC: 12352203

Proprietà

• Origine biologica: rabbit
• Coniugato: FITC conjugate
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 182 kDa
• Reattività contro le specie (prevista in base all’omologia): bovine, horse, pig, rabbit, mouse, canine, human, rat
• Concentrazione: 0.5 mg/mL
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PREX2(80243)

Descrizione

Descrizione generale

PREX2 functions as a RAC1 guanine nucleotide exchange factor (GEF), activating Rac proteins by exchanging bound GDP for free GTP. Its activity is synergistically activated by phosphatidylinositol 3,4,5-trisphosphate and the beta gamma subunits of heterotrimeric G protein. PREX2 mediates the activation of RAC1 in a PI3K-dependent manner. PREX2 may be an important mediator of Rac signaling, acting directly downstream of both G protein-coupled receptors and phosphoinositide 3-kinase.

Immunogeno

Synthetic peptide directed towards the N-terminal region of Human PREX2

Sequenza

Synthetic peptide located within the following region: ERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVH

Stato fisico

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable