SAB2108675

Anti-HMGB1

affinity isolated antibody

• Sinonimo/i: Anti- HMG1, Anti- HMG3, Anti- SBP-1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 25 kDa
• Reattività contro le specie: bovine, guinea pig, human, horse, rabbit, dog, rat, mouse
• Concentrazione: 0.5-1 mg/mL
• tecniche: western blot: suitable
• Numero d’accesso: NM_002128
• N° accesso UniProt: P09429
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... HMGB1(3146)

Descrizione

Immunogeno

Synthetic peptide directed towards the N terminal region of human HMGB1

Azioni biochim/fisiol

HMGB1 belongs to the HMGB family. It contains 2 HMG box DNA-binding domains. The protein binds preferentially single-stranded DNA and unwinds double stranded DNA. The oxidized HMGB1 may accumulate even in cells under oxidative stress.

Sequenza

Synthetic peptide located within the following region: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKT

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable