Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

SAB2108573

Sigma-Aldrich

Anti-GLS2

IgG fraction of antiserum

Sinonimo/i:

Anti- GLS, Anti- LGA, Anti- MGC71567, Anti- hLGA, Anti-GA

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

36 kDa

Reattività contro le specie

rat, horse, mouse, human, dog, pig

Concentrazione

0.5-1 mg/mL

tecniche

immunoblotting: suitable
immunohistochemistry: suitable

Numero d’accesso

NM_013267

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... GLS2(27165)

Descrizione generale

Glutaminase 2 (GLS2) is located in mitochondria and nucleus. The gene is located on human chromosome 12q13. GLS2 protein is expressed in brain, pancreas, cancer cells and cells of the immune system.

Immunogeno

Synthetic peptide directed towards the middle region of human GLS2

Azioni biochim/fisiol

Glutaminase 2 (GLS2) is a mitochondrial phosphate-activated glutaminase that catalyses the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
GLS2 functions as a tumor protein p53 downstream target gene. GLS2 controls the functions of p53, in modulating energy metabolism and antioxidant defense. It might play a critical role in tumorigenesis. The protein negatively controls PI3K (phosphatidylinositol 3-kinase) /AKT (non-specific serine/threonine protein kinase) signalling pathway. GLS2 regulates the neuronal effects of tumor protein p73. The protein might have a pivotal role in radioresistance in cervical cancer patients.

Sequenza

Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Knock-down of glutaminase 2 expression decreases glutathione, NADH, and sensitizes cervical cancer to ionizing radiation
Xiang L, et al.
Biochimica et Biophysica Acta (BBA)-Gene Structure and Expression, 1833(12), 2996-3005 (2013)
Expression of Gls and Gls2 glutaminase isoforms in astrocytes
Cardona C, et al.
Glia, 63(3), 365-382 (2015)
GLS2 is transcriptionally regulated by p73 and contributes to neuronal differentiation
Velletri T, et al.
Cell Cycle, 12(22), 3564-3573 (2013)
Mercedes Martín-Rufián et al.
PloS one, 7(6), e38380-e38380 (2012-06-09)
Glutaminase is expressed in most mammalian tissues and cancer cells, but the regulation of its expression is poorly understood. An essential step to accomplish this goal is the characterization of its species- and cell-specific isoenzyme pattern of expression. Our aim
Juan Liu et al.
Oncotarget, 5(9), 2635-2647 (2014-05-07)
The tumor suppressor p53 and its signaling pathway play a critical role in tumor prevention. As a direct p53 target gene, the role of glutaminase 2 (GLS2) in tumorigenesis is unclear. In this study, we found that GLS2 expression is

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.