SAB2108280

Anti-PITX3 antibody produced in rabbit

affinity isolated antibody

• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 32kDa
• Reattività contro le specie: rat, mouse, bovine, horse, dog, sheep, human, rabbit, guinea pig
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunoblotting: suitable; immunohistochemistry: suitable
• N° accesso NCBI: NM_005029
• N° accesso UniProt: O75364
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PITX3(5309)

Descrizione

Descrizione generale

The paired-like homeodomain transcription factor 3 (PITX3) is located on human chromosome 10q24. It has a characteristic homeodomain. PITX3 is a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human PITX3

Azioni biochim/fisiol

The paired-like homeodomain transcription factor 3 (PITX3) participates in the midbrain dopamine system development. The homeodomain of PITX3 is essential for DNA binding. Single-nucleotide polymorphism in this gene is linked with Parkinson′s disease.
Members of RIEG/PITX homeobox family act as transcription factors. Mutations of PITX3 have been associated with anterior segment mesenchymal dysgenesis (ASMD) and congenital cataracts. PITX3 is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts.

Sequenza

Synthetic peptide located within the following region: MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPG

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable