SAB2108266

Anti-GAPDH Antibody

rabbit polyclonal

• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Nome del prodotto: Anti-GAPDH antibody produced in rabbit, affinity isolated antibody
• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 36kDa
• Reattività contro le specie: guinea pig, rat, horse, human, mouse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunoblotting: suitable
• N° accesso NCBI: NM_002046
• N° accesso UniProt: P04406
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... GAPDH(2597)

Descrizione

Descrizione generale

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) localizes in the cytoplasm but can be translocated to the nucleus depending on cellular conditions. It is a tetramer containing identical chains. The gene encoding this protein is localized on human chromosome 12p13.

Immunogeno

Synthetic peptide directed towards the middle region of human GAPDH

Applicazioni

Anti-GAPDH antibody produced in rabbit has been used in western blotting.

Azioni biochim/fisiol

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) catalyzes the reversible oxidative phosphorylation of glyceraldehyde-phosphate, which is a critical energy-yielding step in carbohydrate metabolism. It binds to several proteins including actin, tubulin, amyloid precursor, polyglutamine peptides, DRPLA (dentatorubral-pallidoluysian atrophy) and huntingtin. Phosphorylated GAPDH associates with cytoskeletal elements and controls microtubule dynamics in the early secretory pathway. GAPDH is also a component of the functional GAIT (interferon-γ-activated inhibitor of translation) mRNP (messenger ribonucleoprotein). GAPDH expression is dysregulated during melanoma progression.

Sequenza

Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable