SAB2107958

Anti-KLF4 antibody produced in rabbit

affinity isolated antibody

• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 50kDa
• Reattività contro le specie: dog, human, guinea pig, mouse, bovine, rat, horse, rabbit
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunoblotting: suitable; immunohistochemistry: suitable
• N° accesso NCBI: NM_004235
• N° accesso UniProt: O43474
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... KLF4(9314)

Descrizione

Immunogeno

Synthetic peptide directed towards the C terminal region of human KLF4

Azioni biochim/fisiol

The mammalian Kruppel-like transcription factor, KLF4 is involved in preventing centrosome amplification following DNA damage caused by gamma-irradiation. It is both necessary and sufficient in preventing centrosome amplification following gamma-radiation-induced DNA damage and does so by transcriptionally suppressing cyclin E expression n. Kruppel-like factor 4 is also known to exhibit checkpoint function during the G1/S and G2/M transitions of the cell cycle.

Sequenza

Synthetic peptide located within the following region: AGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKH

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable