Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

SAB2104121

Sigma-Aldrich

Anti-CHAC2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

21 kDa

Reattività contro le specie

guinea pig, human, mouse, dog, rat, rabbit, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NM_001008708

N° accesso UniProt

Q8WUX2

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CHAC2(494143)

Descrizione generale

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) belongs to the ChaC family of γ-glutamylcyclotransferases. It carries a methionine (Met) residue at the N-terminus.

Immunogeno

Synthetic peptide directed towards the N terminal region of human CHAC2

Applicazioni

Anti-CHAC2, (N-terminal) antibody produced in rabbit has been used in western blot.

Azioni biochim/fisiol

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) helps in degrading glutathione in the cytosol of mammals. In pathways that are independent of ChaC1, ChaC2 would disrupt the expression of nuclear erythroid-2-like factor (Nrf2) and glutamate cysteine ligase. Upregulation of ChaC2 gene can prevent the proliferation of cells. It may be considered as a candidate tumor suppressor gene (TSG) in gastrointestinal cancer.

Sequenza

Synthetic peptide located within the following region: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Shuiping Liu et al.
Cell death & disease, 8(8), e3009-e3009 (2017-08-25)
Tumor suppressor genes play a key role in cancer pathogenesis. Through massive expression profiling we identified CHAC2 as a frequently downregulated gene in gastric and colorectal cancers. Immunohistochemistry and western blot revealed that CHAC2 was downregulated in most tumor tissues
Yen T K Nguyen et al.
Biomolecules, 10(1) (2019-12-28)
Glutathione (GSH) degradation plays an essential role in GSH homeostasis, which regulates cell survival, especially in cancer cells. Among human GSH degradation enzymes, the ChaC2 enzyme acts on GSH to form 5-l-oxoproline and Cys-Gly specifically in the cytosol. Here, we
Amandeep Kaur et al.
The Journal of biological chemistry, 292(2), 638-651 (2016-12-04)
Glutathione degradation plays an important role in glutathione and redox homeostasis, and thus it is imperative to understand the enzymes and the mechanisms involved in glutathione degradation in detail. We describe here ChaC2, a member of the ChaC family of

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.