SAB2103297

Anti-ATP6V1C1, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-ATP6C, Anti-ATP6D, Anti-FLJ20057, Anti-VATC, Anti-Vma5
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 42 kDa
• Reattività contro le specie: dog, horse, human, mouse, bovine, rabbit, rat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NM_001695
• N° accesso UniProt: P21283
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ATP6V1C1(528)

Descrizione

Descrizione generale

ATP6V1C1 (ATPase H⁺ transporting V1 subunit C1) is a subunit and regulator of V-ATPase (vacuolar ATPase).

Immunogeno

Synthetic peptide directed towards the N terminal region of human ATP6V1C1

Azioni biochim/fisiol

ATP6V1C1 (ATPase H⁺ transporting V1 subunit C1) is overexpressed in breast cancer, where it modulates the actin structure in a way that it promotes metastasis. This gene is up-regulated in oral squamous cell carcinoma (OSCC).

Sequenza

Synthetic peptide located within the following region: ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable