Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB2102177

Sigma-Aldrich

Anti-SLC22A6 (ab2) antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-HOAT1, Anti-MGC45260, Anti-OAT1, Anti-PAHT, Anti-Solute carrier family 22 (organic anion transporter), member 6

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

62 kDa

Reattività contro le specie

mouse, guinea pig, human, horse, rat, bovine, rabbit, dog

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso UniProt

Q4U2R8

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SLC22A6(9356)

Categorie correlate

Descrizione generale

Solute carrier family 22 member 6 (SLC22A6) belongs to organic anion transporter-1 family. The protein is expressed in kidney and brain. The gene is located on human chromosome 11q12.3.

Immunogeno

Synthetic peptide directed towards the N terminal region of human SLC22A6

Azioni biochim/fisiol

Solute carrier family 22 member 6 (SLC22A6) is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene.
SLC22A6 regulates the body disposition of a variety of clinically important drugs, such as, anti-HIV therapeutics, antitumor drugs, antibiotics, antihypertensives and anti-inflammatories. Ubiquitination sites of SLC22A6 is involved in the protein kinase C (PKC)-mediated endocytosis of the transporter. It plays an important role in substrate recognition.

Sequenza

Synthetic peptide located within the following region: AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
QC68710
QC12220

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Functional role of the C terminus of human organic anion transporter hOAT1
Xu W, etal.
The Journal of Biological Chemistry, 281(42), 31178-31183 (2006)
Organic anion transporter OAT1 undergoes constitutive and protein kinase C-regulated trafficking through a dynamin-and clathrin-dependent pathway
Zhang Q, et al.
The Journal of Biological Chemistry (2008)
Three ubiquitination sites of organic anion transporter-1 synergistically mediate protein kinase C-dependent endocytosis of the transporter
Li S, et al.
Molecular Pharmacology, mol-113 (2013)
Navaz Karimian Pour et al.
Pharmaceutics, 11(12) (2019-11-27)
Inflammation impacts the expression and function of drug transporters at term-gestation; however, the impact of inflammation on the expression of drug transporters at mid-gestation is largely unknown. Since renal drug transporters play a key role in the clearance of many
Josefin A Jacobsson et al.
Genomics, 90(5), 595-609 (2007-08-24)
The solute carrier family 22 (SLC22) is a large family of organic cation and anion transporters. These are transmembrane proteins expressed predominantly in kidneys and liver and mediate the uptake and excretion of environmental toxins, endogenous substances, and drugs from

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.