SAB2100040

Anti-ACTN3 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-Actinin, α3, Anti-MGC117002, Anti-MGC117005
• Codice UNSPSC: 12352203

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 103 kDa
• Reattività contro le specie: dog, rat, guinea pig, mouse, bovine, rabbit, human, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso UniProt: Q08043
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ACTN3(89)

Descrizione

Immunogeno

Synthetic peptide directed towards the N terminal region of human ACTN3

Azioni biochim/fisiol

Alpha-actinin is an actin-binding protein with multiple roles in different cell types. This protein expression is limited to skeletal muscle. It is localized to the Z-disc and analogous dense bodies, where it helps to anchor the myofibrillar actin filaments.Alpha-actinin is an actin-binding protein with multiple roles in different cell types. This gene expression is limited to skeletal muscle. It is localized to the Z-disc and analogous dense bodies, where it helps to anchor the myofibrillar actin filaments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequenza

Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable