SAB1412087

ANTI-ZNF41 antibody produced in mouse

clone 2C5, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: MGC8941, MRX89, ZNF41
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2C5, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen 36.74 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso NCBI: NM_007130
• N° accesso UniProt: P51814
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ZNF41(7592)

Descrizione

Descrizione generale

This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. Several alternatively spliced transcript variants have been described, however, the full-length nature of only some of them is known. (provided by RefSeq)

Immunogeno

ZNF41 (NP_009061, 221 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAPTHHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHPSV*

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable