SAB1411621

Anti-CD247 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: CD3-ZETA, CD3H, CD3Q, CD3Z, T3Z, TCRZ
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: antigen 18.7 kDa
• Reattività contro le specie: human
• tecniche: proximity ligation assay: suitable; western blot: 1 μg/mL
• N° accesso NCBI: NM_198053
• N° accesso UniProt: P20963
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CD247(919)

Descrizione

Descrizione generale

T cell antigen receptor ζ chain (CD3 ζ), also known as cluster of differentiation 247 (CD247) gene, spanning 88 kb of genomic DNA, is mapped to human chromosome 1q24.2.

The protein encoded by this gene is T-cell receptor ζ, which together with T-cell receptor α/β and γ/δ heterodimers, and with CD3-γ, -δ and -ε, forms the T-cell receptor-CD3 complex. The ζ chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (provided by RefSeq)

Immunogeno

CD247 (NP_932170.1, 1 a.a. ~ 164 a.a) full-length human protein.

Sequence
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Azioni biochim/fisiol

T cell antigen receptor ζ chain (CD3 ζ)/cluster of differentiation 247 (CD247) functions as a key signal transduction component of the T cell antigen receptor (TCR) complex. The encoded protein facilitates optimal effector T-cell function by enhancing receptor expression and signaling. Mutation in the gene increases the risk of susceptibility to systemic lupus erythematosus (SLE). Reduced expression of the gene has been observed in T-cells of cancer, lupus and chronic infectious diseases such as leprosy and tuberculosis patients. CD247 serves as a potent biomarker for determining progression and severity in patients with type 2 diabetes.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable