SAB1406995

Anti-CLEC10A antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: CD301, CLECSF13, CLECSF14, HML, HML2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~35.4 kDa
• Reattività contro le specie: human
• tecniche: western blot: 1 μg/mL
• N° accesso NCBI: NM_182906
• N° accesso UniProt: Q8IUN9
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CLEC10A(10462)

Descrizione

Descrizione generale

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)

Immunogeno

CLEC10A (NP_878910.1, 1 a.a. ~ 316 a.a) full-length human protein.

Sequence
MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH

Applicazioni

Anti-CLEC10A antibody produced in mouse is suitable for western blot assay.

Azioni biochim/fisiol

CLEC10A (C-type lectin domain family 10, member A) functions as a tumor associated macrophages in the tumor progression. It has been predicted that after being expressed by macrophages, glycoreceptor CLEC10A may directly interact with the glycan-binding receptors to identify the presence of certain glycan in human tumors. It has also been reported that macrophage cell surface lectin recognizes a common human carcinoma-associated epitope, Tn Ag.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable