SAB1405302

Monoclonal Anti-ZIC4 antibody produced in mouse

clone 1A9, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: FLJ42609, FLJ45833
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1A9, monoclonal
• Stato: buffered aqueous solution
• PM: antigen ~33.92 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_032153
• N° accesso UniProt: Q8N9L1
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ZIC4(84107)

Descrizione

Descrizione generale

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function. (provided by RefSeq)

Immunogeno

ZIC4 (NP_115529, 249 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQV

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable