SAB1404827

Monoclonal Anti-OLFM1 antibody produced in mouse

clone 2E9-1A2, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: AMY, NOE1, NOELIN1, OlfA
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2E9-1A2, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~44.7 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable
• Isotipo: IgG1κ
• N° accesso NCBI: BC000189
• N° accesso UniProt: Q99784
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... OLFM1(10439)

Descrizione

Descrizione generale

This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogeno

OLFM1 (AAH00189, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable