Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

SAB1403976

Sigma-Aldrich

Monoclonal Anti-IL13 antibody produced in mouse

clone 3H7, purified immunoglobulin, buffered aqueous solution

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

3H7, monoclonal

Forma fisica

buffered aqueous solution

PM

antigen ~38.32 kDa

Reattività contro le specie

human

tecniche

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

Sequenza immunogenica

MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... IL13(3596)

Descrizione generale

This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq

Immunogeno

IL13 (NP_002179, 1 a.a. ~ 146 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Azioni biochim/fisiol

Interleukin-13 (IL-13) has a role in immune activities against infections and influences the function of various cells taking part in the same. It has been studied to be overexpressed in glioblastoma tumors and cell lines. IL-13 stimulates fibrosis in many infectious diseases. Targeted deletion of IL-13 in mice resulted in impaired T-helper 2 (Th2) cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as tumor necrosis factor-α (TNF-α), interleukins-1β, -6 and -8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of immunoglobulin E (IgE). Blocking of IL-13 activity inhibits the pathophysiology of asthma.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Genetic variants of IL-13 signalling and human asthma and atopy.
Heinzmann A
Human Molecular Genetics, 9(4), 549-559 (2000)
T cell responses: naive to memory and everything in between.
Pennock ND
Advances in Physiology Education, 37(4), 273-283 (2013)
IL-4, IL-10 and IL-13 down-regulate monocyte-chemoattracting protein-1 (MCP-1) production in activated intestinal epithelial cells.
Kucharzik T
Clinical and Experimental Immunology, 111(1), 152-157 (1998)
IL-13 mediates IL-33-dependent mast cell and type 2 innate lymphoid cell effects on bronchial epithelial cells.
Deepti R Nagarkar et al.
The Journal of allergy and clinical immunology, 136(1), 202-205 (2015-03-19)
Yan Deng et al.
PloS one, 10(2), e0116682-e0116682 (2015-02-07)
Interleukin-13 (IL-13) is a potent pleiotropic cytokine that is produced by activated CD4 T cells. This study was undertaken to determine the relationship between two IL-13 gene single nucleotide polymorphisms (SNP rs1800925 and SNP rs20541) and the incidence of hepatitis

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.