Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

SAB1401214

Sigma-Aldrich

Anti-IL12RB1 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

CD212, IL-12R-BETA1, IL12RB, MGC34454

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

human

tecniche

western blot: 1 μg/mL

N° accesso NCBI

BC029121

N° accesso UniProt

P42701

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... IL12RB1(3594)

Categorie correlate

Descrizione generale

IL12RB1 (interleukin 12 receptor subunit β1) gene is mapped to human chromosome 19p13.11. The encoded protein is a member of type I transmembrane receptors.
Rabbit polyclonal antibody raised against a full-length human IL12RB1 protein.

Immunogeno

IL12RB1 (AAH29121.1, 1 a.a. ~ 381 a.a) full-length human protein.

Sequence
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF

Azioni biochim/fisiol

IL12RB1 (interleukin 12 receptor subunit β1) regulates the physiological responses to a number of diseases. IL12RB1 binds to both IL 12 (interleukin 12) and IL 23 (interleukin 23) at a common binding point 12p40-domain.Variation in the gene affects the receptor sensitivity towards the cytokines IL 12 and IL 23. Thus, the gene is associated with the diseases that are regulated by IL 12 and IL 23. Susceptibility to diseases such as tuberculosis, nontuberculous mycobacterial infection, malaria, cancer, pediatric asthma, and atopic dermatitis is related to IL12RB1.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Kai Wang et al.
American journal of human genetics, 84(3), 399-405 (2009-03-03)
Previous genome-wide association (GWA) studies typically focus on single-locus analysis, which may not have the power to detect the majority of genuinely associated loci. Here, we applied pathway analysis using Affymetrix SNP genotype data from the Wellcome Trust Case Control
Amy J Turner et al.
Proceedings of the National Academy of Sciences of the United States of America, 112(50), 15414-15419 (2015-12-02)
Human interleukin 12 and interleukin 23 (IL12/23) influence susceptibility or resistance to multiple diseases. However, the reasons underlying individual differences in IL12/23 sensitivity remain poorly understood. Here we report that in human peripheral blood mononuclear cells (PBMCs) and inflamed lungs
The introduction of RNA-DNA differences underlies interindividual variation in the human IL12RB1 mRNA repertoire.
Turner AJ
Proceedings of the National Academy of Sciences of the USA, 112(50), 15414-15419 (2015)
Diverse genome-wide association studies associate the IL12/IL23 pathway with Crohn Disease.
Wang K
American Journal of Human Genetics, 84(3), 399-405 (2009)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.