MSST0064

SILu^™Prot Insulin, human

recombinant, expressed in Pichia pastoris, SIL MS Protein Standard, ¹⁵N -labeled

• Sinonimo/i: in situ Proximity Ligation Assay reagent, Insulin
• Codice UNSPSC: 23201100
• NACRES: NA.32

Proprietà

• Ricombinante: expressed in Pichia pastoris
• Livello qualitativo: 200
• Saggio: ≥95% (HPLC)
• Forma fisica: dry pellets
• Potenza: ≥97% (Heavy amino acids incorporation efficiency by MS)
• Compatibilità: suitable for mass spectrometry (standard)
• N° accesso UniProt: P01308 (25-54, B chain; 90-110, A chain)
• Condizioni di spedizione: ambient
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... INS(3630)

Descrizione

Descrizione generale

SILu^™ Prot Insulin is a recombinant, stable ¹⁵N isotope-labeled human Insulin Expressed in P. pastoris, it is designed to be used as an internal standard for bioanalysis of Insulin in mass-spectrometry. SILu^™ Prot Insulin is a disulfate bonded hetero-dimer protein composed of two chains. Chain A of 21 amino acids and a thoretical amolecular mass of 2408.5; Chain B of 30 amino acids and a thoretical amolecular mass of 3468.7 (Note that Thr30 in chain B is not ¹⁵N labeled).

Azioni biochim/fisiol

Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, protein, and fat.

Sequenza

A chain: GIVEQCCTSICSLYQLENYCN
B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Stato fisico

Supplied as dried pellet from a solution containing 1% acetic acid.

Note legali

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable