MSST0045

SILu^™Prot TIMP2, Metalloproteinase inhibitor 2 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• Codice UNSPSC: 23201100
• NACRES: NA.12

Proprietà

• Ricombinante: expressed in HEK 293 cells
• Livello qualitativo: 200
• Saggio: ≥98% (SDS-PAGE)
• Forma fisica: lyophilized powder
• Potenza: ≥98% Heavy amino acids incorporation efficiency by MS
• Compatibilità: suitable for mass spectrometry (standard)
• N° accesso UniProt: P16035
• Temperatura di conservazione: −20°C

Descrizione

Descrizione generale

SILu^™Prot TIMP2 is a recombinant, stable isotope-labeled human TIMP2 which incorporates [¹³C₆, ¹⁵N₄]-Arginine and ^[13C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of TIMP2 in mass-spectrometry. SILu^™Prot TIMP2 is a protein of 194 amino acids , with a calculated molecular mass of 21.7 kDa.

Azioni biochim/fisiol

While the mammalian TIMP family has four members, TIMP-2 is a unique family member in that in addition to inhibiting matrix metalloproteinases (MMPs), TIMP-2 selectively interacts with MT1-MMP to facilitate the cell-surface activation of pro-MMP-2.1 Thus, TIMP-2 functions both as an inhibitor of MMPs, and is required for the cellular mechanism of pro-MMP-2 activation. Recently, it was validated that combination of TIMP-2 with another urinary cell-cycle arrest biomarkers, i.e. the insulin-like growth factor-binding protein 7 (IGFBP7) may predict the risk of moderate and severe acute kidney injury (AKI) in critically ill patients. For postoperative surgical intensive care unit patients, a single urinary TIMP2•IGFBP7 test accurately identified patients at risk for developing AKI within the ensuing 12 hours and its inclusion in clinical risk prediction models significantly enhances their performance.

Sequenza

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Stato fisico

Supplied as a lyophilized powder containing phosphate buffered saline.

Note legali

SILu is a trademark of Sigma-Aldrich Co. LLC

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable