MSST0014

SILu^™Lite AMBP Alpha-1 Microglycoprotein human

recombinant, expressed in HEK 293 cells, MS protein standard

• Sinonimo/i: Alpha-1-microglobulin, Complex-forming glycoprotein heterogeneous in charge
• Codice UNSPSC: 23201100
• NACRES: NA.12

Proprietà

• Origine biologica: human
• Livello qualitativo: 200
• Ricombinante: expressed in HEK 293 cells
• Tag: His tagged
• Saggio: ≥98% (SDS-PAGE)
• Forma fisica: lyophilized powder
• tecniche: mass spectrometry (MS): suitable
• Compatibilità: suitable for mass spectrometry (internal calibrator)
• N° accesso UniProt: P02760
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... AMBP(259)

Descrizione

Descrizione generale

SILu^™ Lite AMBP is a recombinant human protein expressed in human 293 cells. It is a monomer of 204 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~23 kDa. SILu^™ Lite AMBP is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Azioni biochim/fisiol

AMBP is synthesized by the liver. Approximately half of the circulating protein is complexed to IgA. The free form of AMBP is filtered by the glomerulus and reabsorbed by proximal tubule cells. AMBP has been found to be a sensitive biomarker for proximal tubular dysfunction even in the early phase of injury when no histologic damage is observable. In addition, urinary AMBP has been proposed to be a useful marker of tubular dysfunction even in low-gestational-age preterm infants, a population at high risk for AKI (Acute Kidney Injury). Urinary AMBP is also a marker of kidney damage in type 2 diabetes.

Sequenza

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVDYKDDDDKGHHHHHHHHGGQ

Stato fisico

Supplied as a lyophilized powder containing phosphate buffered saline.

Note legali

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable