MSST0008

SILu^™Lite CLU Clusterin human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Sinonimo/i: Apolipoprotein J, Clusterin, Testosterone-repressed prostate message 2 (TRPM-2)
• Codice UNSPSC: 23201100

Proprietà

• Origine biologica: human
• Livello qualitativo: 200
• Ricombinante: expressed in HEK 293 cells
• Saggio: ≥98% (SDS-PAGE)
• Forma fisica: lyophilized powder
• tecniche: mass spectrometry (MS): suitable
• Compatibilità: suitable for mass spectrometry (internal calibrator)
• N° accesso UniProt: P10909
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... CLU(1191)

Descrizione

Descrizione generale

SILu^™Lite Clusterin is a recombinant human protein expressed in human 293 cells. It is a heterodimer of 2 subunits (alpha and beta) consisting of 427 amino acids (including N-terminal polyhistidine and V5 tags), with a calculated molecular weight of 50 kDa. SILu^™Lite Clusterin is designed to be used as an internal standard for bioanalysis of Clusterin in mass-spectrometry.

Azioni biochim/fisiol

Clusterin is a secreted glycosylated, 80-kDa disulfide-linked heterodimer of alpha and beta subunits (produced by internal cleavage). Clusterin is expressed in virtually all tissues and found in all human fluids. It is involved in numerous physiological processes important for carcinogenesis and tumor growth, including anti-apoptotic cell survival, cell cycle regulation, cell adhesion, tissue remodeling and lipid transportation. Clusterin also exists as a nuclear protein. The secreted form of Clusterin has extracellular chaperone and anti-apoptotic activities while the nuclear form acts as a proapoptotic factor.

Sequenza

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREESDPSRGPFEGKPIPNPLLGLDSTRTGHHHHHHHHGGQ

Stato fisico

Supplied as a lyophilized powder containing phosphate buffered saline.

Note legali

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable