HPA041162

Anti-TK2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Thymidine Kinase 2, Mitochondrial
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA041162

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: mouse, human
• tecniche: immunohistochemistry: 1:50-1:200
• Sequenza immunogenica: YVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRD
• N° accesso UniProt: O00142
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TK2(7084)

Descrizione

Descrizione generale

Thymidine kinase 2, mitochondrial (TK2) is a deoxyribonucleoside kinase encoded by the gene mapped to human chromosome 16q21. The encoded protein is localized mainly in mitochondria.{4 }

Immunogeno

thymidine kinase 2, mitochondrial recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-TK2 antibody produced in rabbit has been used in sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) to visualize thymidine Kinase 2 (TK2) protein on a nitrocellulose membrane.

Azioni biochim/fisiol

Thymidine kinase 2, mitochondrial (TK2) phosphorylates thymidine (dT), deoxyuridine and deoxycytidine (dC). In addition, it also catalyzes the phosphorylation of a number of antiviral and anticancer nucleoside analogs and thus, plays a key role in mitochondrial toxicities caused by nucleoside analogues. TK2 also aids in regulation and production of mitochondrial DNA (mtDNA). Mutation or loss of TK2 can cause mitochondrial disease and are associated with mtDNA depletion or deletions in the affected tissues.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST82263

Stato fisico

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable