Passa al contenuto
Merck
Tutte le immagini(5)

Documenti

HPA039557

Sigma-Aldrich

Anti-TAZ antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-BTHS, Anti-CMD3A, Anti-EFE, Anti-EFE2, Anti-G4.5, Anti-Tafazzin, Anti-XAP-2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Numero MDL:
Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Forma fisica

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

tecniche

immunohistochemistry: 1:20- 1:50

Sequenza immunogenica

WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TAZ(6901)

Descrizione generale

Tafazzin (TAZ) is encoded by the WW domain containing transcription regulator 1 (WWTR1) gene mapped to human chromosome Xq28. The encoded protein contains 400 amino acids. It is characterized by a conserved WW domain, implicated in binding PPXY motif, a coiled-coil region associated with protein-protein interaction and a C-terminal motif involved in binding the PDZ domain.

Immunogeno

tafazzin recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-TAZ antibody produced in rabbit has been used in immunohistochemistry and immunoprecipitation.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Azioni biochim/fisiol

Tafazzin (TAZ) plays a vital role in the various cellular process including cell proliferation, differentiation, apoptosis, migration, invasion, epithelial-mesenchymal transition (EMT) and stemness in multiple human cancers. TAZ associates with other transcription factors such as RUNX2 (runt-related transcription factor 2), PPAR (peroxisome proliferator-activated receptor), PAX3 and 8 (paired box gene 3 and 8) and TTF1 (thyroid transcription factor 1) and plays an essential role in osteoblastic, myogenic and adipogenic differentiation.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST77964

Stato fisico

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Surajit Pathak et al.
PloS one, 9(5), e98317-e98317 (2014-05-27)
Tafazzin (TAZ), a transmembrane protein contributes in mitochondrial structural and functional modifications through cardiolipin remodeling. TAZ mutations are associated with several diseases, but studies on the role of TAZ protein in carcinogenesis and radiotherapy (RT) response is lacking. Therefore we
Tafazzin protein expression is associated with tumorigenesis and radiation response in rectal cancer: a study of Swedish clinical trial on preoperative radiotherapy.
Pathak S
PLoS ONE, 9 (2014)
Yugang Wen et al.
Journal of personalized medicine, 10(4) (2020-10-18)
Radiation therapy has long been contemplated as an important mode in the treatment of rectal cancer. However, there are few ideal tools available for clinicians to make a radiotherapy decision at the time of diagnosis for rectal cancer. The purpose
Regulation of TAZ in cancer.
Zhou X and Lei QY
Protein & cell, 7, 548-561 (2016)
A role for TAZ in migration, invasion, and tumorigenesis of breast cancer cells.
Chan SW
Cancer Research, 68, 2592-2598 (2008)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.