HPA026816
Anti-SEC11C antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinonimo/i:
Anti-SEC11 homolog C (S. cerevisiae), Anti-SEC11L3, Anti-SPC21, Anti-SPCS4C
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Nome Commerciale
Prestige Antibodies® Powered by Atlas Antibodies
Stato
buffered aqueous glycerol solution
Reattività contro le specie
human
Convalida avanzata
recombinant expression
Learn more about Antibody Enhanced Validation
tecniche
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
Sequenza immunogenica
MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... SEC11C(90701)
Descrizione generale
SEC11 homolog C (SEC11C), mapped to human chromosome 18, encodes signal peptidase complex subunit 21 (SPC21) protein. The encoded protein is characterized with two hydrophobic domains, one at amino terminal end between signal peptidase complex 18 (SPC 18) residues 17-57, which functions as a transmembrane anchor and other hydrophobic domain is mapped between SPC 18 residues 144 and 176.
Immunogeno
SEC11 homolog C (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Applicazioni
Anti-SEC11C antibody has been used in western blotting.
Anti-SEC11C antibody produced in rabbit has been used in western blotting. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Azioni biochim/fisiol
In gastric cancer, SPC18 (signal peptidase complex 18) protein, coded by SEC11C (SEC11 homolog C, signal peptidase complex subunit), helps in the development through TGF-α(transforming growth factor alpha)secretion. SPC proteins present in vitro may participate in the mechanism of signal peptide processing and protein translocation.
Caratteristiche e vantaggi
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST70171
Stato fisico
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Note legali
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
A CRISPR screen defines a signal peptide processing pathway required by flaviviruses.
Zhang R, et al.
Nature, 535(7610), 164-164 (2016)
Signal peptidase complex 18, encoded by SEC11A, contributes to progression via TGF-a secretion in gastric cancer.
Oue N
Oncogene, 33(30), 3918-3926 (2014)
Paco Hulpiau et al.
Cellular and molecular life sciences : CMLS, 73(5), 1103-1116 (2015-09-18)
Paracaspases and metacaspases are two families of caspase-like proteins identified in 2000. Up until now paracaspases were considered a single gene family with one known non-metazoan paracaspase in the slime mold Dictyostelium and a single animal paracaspase called MALT1. Human
Two subunits of the canine signal peptidase complex are homologous to yeast SEC11 protein.
Shelness GS, Blobel G
The Journal of Biological Chemistry, 265(16), 9512-9519 (1990)
Rong Zhang et al.
Nature, 535(7610), 164-168 (2016-07-08)
Flaviviruses infect hundreds of millions of people annually, and no antiviral therapy is available. We performed a genome-wide CRISPR/Cas9-based screen to identify host genes that, when edited, resulted in reduced flavivirus infection. Here, we validated nine human genes required for
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.