HPA023874

Anti-BAIAP2L1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab3

• Sinonimo/i: Anti-BAI1-associated protein 2-like protein 1, Anti-Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1, Anti-Insulin receptor tyrosine kinase substrate
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA023874
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: independent; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Sequenza immunogenica: DYLECLSMGAAADRRADSARTTSTFKAPASKPETAAPNDANGTAKPPFLSGENPFATVKLRPTVTNDRSAP
• N° accesso UniProt: Q9UHR4
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... BAIAP2L1(55971)

Descrizione

Descrizione generale

Brain-specific angiogenesis inhibitor 1 (BAI1)-associated protein 2-like 1 (BAIAP2L1), also known as insulin receptor tyrosine kinase substrate (IRTKS), is a 511 amino-acid protein with molecular weight of approximately 57kDa. The gene coding for this protein is mapped to human chromosome 7q21.3-q22.1. BAIAP2L1 belongs to the insulin receptor substrate p53 (IRSp53) protein family. The encoded protein contains bin–amphiphysin–rvs (BAR) domain involved in binding highly curved, negatively charged membranes and the SRC homology 3 domain (SH3 domain) involved in multiple protein-protein interactions.

Immunogeno

Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Azioni biochim/fisiol

Brain-specific angiogenesis inhibitor 1 (BAI1)-associated protein 2-like 1 (BAIAP2L1) plays a vital role in plasma membrane protrusion and actin cytoskeleton remodeling during cell morphogenesis and movement. The encoded protein acts as a novel biomarker for human ovarian cancer and it also supports cell proliferation by activating epidermal growth factor receptor (EGFR) activated extracellular-signal regulated kinase (ERK) pathway in hepatocellular carcinoma. BAIAP2L1/ insulin receptor tyrosine kinase substrate (IRTKS) is identified as a substrate of insulin receptor tyrosine kinase. Increased expression of the protein promotes quick wound healing of HT1080 cells in a src-dependent manner.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74835

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable