HPA021676
Anti-RACK1 antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Sinonimo/i:
Anti-Cell proliferation-inducing gene 21 protein, Anti-Guanine nucleotide-binding protein subunit beta-2-like 1, Anti-Guanine nucleotide-binding protein subunit beta-like protein 12.3, Anti-HLC-7, Anti-RACK1, Anti-Receptor for activated C kinase, Anti-Receptor of activated protein kinase C 1
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Coniugato:
unconjugated
application:
IHC (p)
WB
WB
Clone:
polyclonal
Reattività contro le specie:
mouse, human
citations:
5
tecniche:
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 0.04-0.4 μg/mL
western blot: 0.04-0.4 μg/mL
Prodotti consigliati
Origine biologica
rabbit
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous glycerol solution
Reattività contro le specie
mouse, human
tecniche
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 0.04-0.4 μg/mL
Sequenza immunogenica
CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... GNB2L1(10399)
Descrizione generale
Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a stably expressed housekeeping gene localized in alveolar macrophage and neutrophils. The gene has been predicted to encode a protein RACK1 (Receptor for activated C kinase 1). It is mapped on the telomeric position of chromosome 5q35.3.
Immunogeno
Guanine nucleotide-binding protein subunit beta-2-like 1 recombinant protein epitope signature tag (PrEST)
Applicazioni
Anti-GNB2L1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Azioni biochim/fisiol
Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a scaffold protein highly involved in the binding and anchorage of protein kinase C. It has been predicted that GNB2L1 may act as a regulatory cofactor of multidrug resistance protein (MDR3/ABCB4) and is vital for the plasma membrane localization and translocation function of ABCB4.
Caratteristiche e vantaggi
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST74729
Stato fisico
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Note legali
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Xiaozhu Zhang et al.
BMC molecular biology, 6, 4-4 (2005-02-22)
Reference genes, which are often referred to housekeeping genes, are frequently used to normalize mRNA levels between different samples. However the expression level of these genes may vary among tissues or cells, and may change under certain circumstances. Thus the
Yuki Ikebuchi et al.
Hepatology research : the official journal of the Japan Society of Hepatology, 39(11), 1091-1107 (2009-08-14)
Multidrug resistance protein 3 (MDR3/ABCB4), located on the bile canalicular membrane of hepatocytes, is responsible for the translocation of phosphatidylcholine across the plasma membrane, and its hereditary defect causes liver disorders, such as progressive familial intrahepatic cholestasis type 3. We
Shu Wang et al.
Molecular biology reports, 30(1), 53-60 (2003-04-12)
During a large-scale screen of a human fetal brain cDNA library, a novel human gene GNB2L1 encoding a novel RACK (receptor of activated protein kinase C) protein was isolated and sequenced. The cDNA is 1142 bp long and has a
T Ishii et al.
The European respiratory journal, 27(2), 300-306 (2006-02-03)
The stability of housekeeping genes is critical when performing gene expression studies. To date, there have been no studies that look at the stability of commonly used housekeeping genes in alveolar macrophages. Expression levels may be affected by culture, stimulation
Motoyuki Otsuka et al.
PloS one, 6(9), e24359-e24359 (2011-09-22)
MicroRNAs (miRNAs) are important regulators of gene expression that control physiological and pathological processes. A global reduction in miRNA abundance and function is a general trait of human cancers, playing a causal role in the transformed phenotype. Here, we sought
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.