HPA019696

Anti-KRT76 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

• Sinonimo/i: Anti-CK 2P, Anti-Cytokeratin-2P, Anti-K2P, Anti-K76, Anti-Keratin, type II cytoskeletal 2 oral, Anti-Keratin-76
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA019696

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunohistochemistry: 1:200- 1:500
• Sequenza immunogenica: LETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFK
• N° accesso UniProt: Q01546
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... KRT76(51350)

Descrizione

Descrizione generale

KRT76 (Keratin 76) is a type II epithelial structural protein belonging to the intermediate filament (IF) group of proteins. Structurally, it is composed of α-helical, rod shaped central domain, which is responsible for filament formation. Non-helical head and tail domains flank the central domain. It is expressed in the suprabasal cell layers of oral masticatory epithelium.

Immunogeno

Keratin, type II cytoskeletal 2 oral recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-KRT76 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Azioni biochim/fisiol

KRT76 (Keratin 76) is a building block of epidermal cytoskeleton involved in wide range of cellular functions including protection from apoptosis, and injury, regulation of epithelial polarity, control of cell size and protein translation. It forms a link between the intermediate filament cytoskeleton network and tight junctions. In mice, KRT76 plays a vital role in postnatal survival. Its downregulated expression has been reported in oral carcinogenesis of human.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74775

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable